PDB entry 3cvl

View 3cvl on RCSB PDB site
Description: Structure of Peroxisomal Targeting Signal 1 (PTS1) binding domain of Trypanosoma brucei Peroxin 5 (TbPEX5)complexed to T. brucei Phosphofructokinase (PFK) PTS1 peptide
Class: transport protein
Keywords: TPR motifs, TPR protein, Peroxin 5, PEX5, PTS1 binding domain, Protein-peptide complex, Receptor, TPR repeat, TRANSPORT PROTEIN
Deposited on 2008-04-18, released 2008-06-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.215
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome targeting signal 1 receptor PEX5
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PEX5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U7C3
      • engineered (49-50)
    Domains in SCOPe 2.02: d3cvla_
  • Chain 'B':
    Compound: T. brucei PFK PTS1 peptide Ac-HEELAKL
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cvlA (A:)
    ghmlqnntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqaapereeawrs
    lgltqaenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawllsqp
    qyeqlgsvnlqadvdiddlnvqsedfffaapneyrecrtllhaalemnpndaqlhaslgv
    lynlsnnydsaaanlrravelrpddaqlwnklgatlangnrpqealdaynraldinpgyv
    rvmynmavsysnmsqydlaakqlvraiymqvggttptgeasreatrsmwdffrmllnvmn
    rpdlveltyaqnvepfakefglqsmll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cvlA (A:)
    tdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqaapereeawrslgltqae
    nekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawllsqpqyeqlff
    faapneyrecrtllhaalemnpndaqlhaslgvlynlsnnydsaaanlrravelrpddaq
    lwnklgatlangnrpqealdaynraldinpgyvrvmynmavsysnmsqydlaakqlvrai
    ymqvggttpasreatrsmwdffrmllnvmnrpdlveltyaqnvepfakefglqs
    

  • Chain 'B':
    No sequence available.