PDB entry 3cvi

View 3cvi on RCSB PDB site
Description: How TCR-like antibody recognizes MHC-bound peptide
Class: immune system
Keywords: fab, immune system
Deposited on 2008-04-18, released 2008-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 25-D1.16 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CVI (0-218)
    Domains in SCOPe 2.06: d3cvih1
  • Chain 'L':
    Compound: 25-D1.16 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CVI (0-208)
    Domains in SCOPe 2.06: d3cvil1, d3cvil2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cviH (H:)
    vllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigdinpnnggtiyn
    qkfkgkatltvdksssaaymevrsltsedtavyycarkpyygnfawfaywgqgtlvtvsa
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cviH (H:)
    vllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigdinpnnggtiyn
    qkfkgkatltvdksssaaymevrsltsedtavyycarkpyygnfawfaywgqgtlvtvsa
    akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cviL (L:)
    iqvtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpdr
    fsgsgsrkdytliitslqtedvatyycqqywstpltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfn