PDB entry 3cv9

View 3cv9 on RCSB PDB site
Description: Crystal structure of vitamin D hydroxylase cytochrome P450 105A1 (R73A/R84A mutant) in complex with 1alpha,25-dihydroxyvitamin D3
Class: oxidoreductase
Keywords: p450, beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase
Deposited on 2008-04-18, released 2008-11-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-SU1
    Species: Streptomyces griseolus [TaxId:1909]
    Gene: CYP105A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18326 (Start-405)
      • engineered (72)
      • engineered (83)
      • see remark 999 (307)
      • expression tag (406-407)
    Domains in SCOPe 2.03: d3cv9a_
  • Heterogens: HEM, VDX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cv9A (A:)
    mtdtattpqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaa
    rkllgdprlssnatddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrik
    gmrpeveevvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrl
    vqstdaqsaltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistaml
    lliaghettasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvat
    adievegqliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnl
    arlelevilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cv9A (A:)
    pqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkllgdp
    rlssnatddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmrpeve
    evvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqstdaq
    saltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllliaghe
    ttasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadieveg
    qliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarlelev
    ilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwhh