PDB entry 3cuv

View 3cuv on RCSB PDB site
Description: Tracking structure activity relationships of glycogen phosphorylase inhibitors: synthesis, kinetic and crystallographic evaluation of analogues of N-(-D-glucopyranosyl)-N'-oxamides
Class: transferase
Keywords: glycogen phosphorylase, structure, catalytic site, rational inhibitor design, Acetylation, Allosteric enzyme, Carbohydrate metabolism, Glycogen metabolism, Glycosyltransferase, Nucleotide-binding, Phosphoprotein, Pyridoxal phosphate, Transferase
Deposited on 2008-04-17, released 2009-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cuva_
  • Heterogens: 475, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cuvA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cuvA (A:)
    krkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwi
    rtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieed
    aglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnp
    wekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsaka
    pndnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkss
    knfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpea
    lerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmah
    lciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeii
    aerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslf
    dvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikli
    taigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfml
    ngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiie
    qlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvir
    niatsgkfssdrtiaqyareiwgvepsrqrlp