PDB entry 3cup

View 3cup on RCSB PDB site
Description: Crystal structure of the MHC class II molecule I-Ag7 in complex with the peptide GAD221-235
Class: immune system
Keywords: Histocompatability antigen, MHC class II, I-Ag7, Glycoprotein, Immune response, Membrane, MHC II, Transmembrane, IMMUNE SYSTEM
Deposited on 2008-04-16, released 2009-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, A-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Aa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04228 (Start-181)
      • expression tag (182-184)
    Domains in SCOPe 2.08: d3cupa1, d3cupa2, d3cupa3
  • Chain 'B':
    Compound: MHC class II H2-IA-beta chain linked to GAD221-235 peptide
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6LDA5 (Start-20)
      • linker (21)
    • Uniprot Q31135 (Start-213)
  • Heterogens: NAG, EPE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cupA (A:)
    eddieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfep
    qgglqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppv
    initwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlk
    hwssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cupA (A:)
    ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
    lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhws
    sa
    

  • Chain 'B':
    No sequence available.