PDB entry 3cun

View 3cun on RCSB PDB site
Description: Aminoacyl-tRNA synthetase ribozyme
Class: RNA/RNA binding
Keywords: ARS ribozyme catalytic RNA, RNA/RNA binding COMPLEX
Deposited on 2008-04-16, released 2008-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.252
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.07: d3cuna_
  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.07: d3cunb_
  • Chain 'C':
    Compound: RNA (92-mer)
  • Chain 'D':
    Compound: RNA (92-mer)
  • Heterogens: MG, CO, K

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cunA (A:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cunA (A:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cunB (B:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cunB (B:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.