PDB entry 3cum

View 3cum on RCSB PDB site
Description: Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from Pseudomonas aeruginosa PAO1
Class: oxidoreductase
Keywords: APC60124, 3-hydroxyisobutyrate dehydrogenase, Pseudomonas aeruginosa PA01, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Oxidoreductase
Deposited on 2008-04-16, released 2008-04-29
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-29, with a file datestamp of 2008-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 3-hydroxyisobutyrate dehydrogenase
    Species: Pseudomonas aeruginosa PAO1
    Gene: PA0743
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cuma1, d3cuma2
  • Heterogens: ACT, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cumA (A:)
    ghmkqiafiglghmgapmatnllkagyllnvfdlvqsavdglvaagasaarsardavqga
    dvvismlpasqhveglyldddgllahiapgtlvlecstiaptsarkihaaarerglamld
    apvsggtagaaagtltfmvggdaealekarplfeamgrnifhagpdgagqvakvcnnqll
    avlmigtaeamalgvangleakvlaeimrrssggnwalevynpwpgvmenapasrdysgg
    fmaqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyaerdfsvvqklfdptqgq
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cumA (A:)
    mkqiafiglghmgapmatnllkagyllnvfdlvqsavdglvaagasaarsardavqgadv
    vismlpasqhveglyldddgllahiapgtlvlecstiaptsarkihaaarerglamldap
    vsggtagaaagtltfmvggdaealekarplfeamgrnifhagpdgagqvakvcnnqllav
    lmigtaeamalgvangleakvlaeimrrssggnwalevynpwpgvmenapasrdysggfm
    aqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyaerdfsvvqklfdptq