PDB entry 3cuf

View 3cuf on RCSB PDB site
Description: Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellobiose-like isofagomine
Class: hydrolase
Keywords: CEX, XYLANASE, Isofagomine inhibitor, TIM BARREL, Glycosidase, Hydrolase
Deposited on 2008-04-16, released 2009-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exo-beta-1,4-glucanase
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Gene: Cex
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cufa_
  • Heterogens: 9MR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cufA (A:)
    attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
    gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
    swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
    nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
    psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
    kkpayaavmeafgas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cufA (A:)
    attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
    gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
    swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
    nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
    psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
    kkpayaavmeafga