PDB entry 3cue

View 3cue on RCSB PDB site
Description: Crystal structure of a TRAPP subassembly activating the Rab Ypt1p
Class: protein transport
Keywords: membrane traffic, GEF, tethering complex, Rab activation, guanine nucleotide exchange factor, Endoplasmic reticulum, ER-Golgi transport, Golgi apparatus, Transport, Lipoprotein, Palmitate, GTP-binding, Nucleotide-binding, Phosphoprotein, Prenylation, Protein transport
Deposited on 2008-04-16, released 2008-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.265
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transport protein particle 23 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: TRS23
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transport protein particle 31 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: TRS31
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Transport protein particle 18 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET5
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transport protein particle 22 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET3
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Transport protein particle 22 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET3
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: GTP-binding protein YPT1
    Species: SACCHAROMYCES CEREVISIAE
    Gene: YPT1, YP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cuef1
  • Chain 'G':
    Compound: Transport protein particle 23 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: TRS23
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Transport protein particle 31 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: TRS31
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Transport protein particle 18 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET5
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Transport protein particle 22 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET3
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Transport protein particle 22 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET3
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: GTP-binding protein YPT1
    Species: SACCHAROMYCES CEREVISIAE
    Gene: YPT1, YP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cuel1
  • Chain 'M':
    Compound: Transport protein particle 23 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: TRS23
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Transport protein particle 31 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: TRS31
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Transport protein particle 18 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET5
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Transport protein particle 22 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET3
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Transport protein particle 22 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET3
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: GTP-binding protein YPT1
    Species: SACCHAROMYCES CEREVISIAE
    Gene: YPT1, YP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cuer1
  • Chain 'S':
    Compound: Transport protein particle 23 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: TRS23
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Transport protein particle 31 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: TRS31
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Transport protein particle 18 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET5
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Transport protein particle 22 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET3
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Transport protein particle 22 kDa subunit
    Species: SACCHAROMYCES CEREVISIAE
    Gene: BET3
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: GTP-binding protein YPT1
    Species: SACCHAROMYCES CEREVISIAE
    Gene: YPT1, YP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cuex1
  • Heterogens: PLM

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cueF (F:)
    mnseydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklq
    iwdtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvg
    nkcdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlne
    ttqkkedkgnvnlkgqsltntgggcc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cueF (F:)
    eydylfklllignsgvgksclllrfsddyistigvdfkiktveldgktvklqiwdtagqe
    rfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkcdlkdk
    rvveydvakefadankmpfletsaldstnvedafltmarqikesms
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3cueL (L:)
    mnseydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklq
    iwdtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvg
    nkcdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlne
    ttqkkedkgnvnlkgqsltntgggcc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cueL (L:)
    eydylfklllignsgvgksclllrfsddyistigvdfkiktveldgktvklqiwdtagqe
    rfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkcdlkdk
    rvveydvakefadankmpfletsaldstnvedafltmarqikesms
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3cueR (R:)
    mnseydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklq
    iwdtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvg
    nkcdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlne
    ttqkkedkgnvnlkgqsltntgggcc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cueR (R:)
    eydylfklllignsgvgksclllrfsddyistigvdfkiktveldgktvklqiwdtagqe
    rfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkcdlkdk
    rvveydvakefadankmpfletsaldstnvedafltmarqikesms
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3cueX (X:)
    mnseydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklq
    iwdtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvg
    nkcdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlne
    ttqkkedkgnvnlkgqsltntgggcc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cueX (X:)
    eydylfklllignsgvgksclllrfsddyistigvdfkiktveldgktvklqiwdtagqe
    rfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkcdlkdk
    rvveydvakefadankmpfletsaldstnvedafltmarqikesms