PDB entry 3cu9

View 3cu9 on RCSB PDB site
Description: High resolution crystal structure of 1,5-alpha-L-arabinanase from Geobacillus Stearothermophilus
Class: hydrolase
Keywords: Arabinanase, Glycosyl Hydrolase, High resolution, beta-propeller, Geobacillus stearothermophilus, HYDROLASE
Deposited on 2008-04-16, released 2009-04-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: 0.147
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intracellular arabinanase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: abn
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cu9a_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cu9A (A:)
    vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
    wvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtldp
    rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
    aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
    pyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqir
    plywddegwpylsv