PDB entry 3cu1

View 3cu1 on RCSB PDB site
Description: Crystal Structure of 2:2:2 FGFR2D2:FGF1:SOS complex
Class: Transferase/Hormone
Keywords: Fibroblast growth factor 1, Fibroblast growth factor receptor 2, D2 domain, sucrose octa sulfate, Alternative splicing, ATP-binding, Disease mutation, Ectodermal dysplasia, Glycoprotein, Heparin-binding, Immunoglobulin domain, Kinase, Lacrimo-auriculo-dento-digital syndrome, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase, Acetylation, Angiogenesis, Developmental protein, Differentiation, Mitogen, Transferase/Hormone COMPLEX
Deposited on 2008-04-15, released 2009-04-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.185
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: HOMO SAPIENS
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cu1a_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: HOMO SAPIENS
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cu1b_
  • Chain 'C':
    Compound: Fibroblast growth factor receptor 2
    Species: HOMO SAPIENS
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cu1c_
  • Chain 'D':
    Compound: heparin-binding growth factor 1
    Species: HOMO SAPIENS
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cu1d_
  • Heterogens: SCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cu1A (A:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cu1B (B:)
    nykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
    mdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthyg
    qkailflplpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cu1B (B:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cu1C (C:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cu1D (D:)
    nykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
    mdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthyg
    qkailflplpv