PDB entry 3ctt

View 3ctt on RCSB PDB site
Description: Crystal complex of N-terminal Human Maltase-Glucoamylase with Casuarine
Class: hydrolase
Keywords: Glycosyl Hydrolase Family 31, alpha-glucosidase, Glycoprotein, Glycosidase, Membrane, Multifunctional enzyme, Signal-anchor, Sulfation, Transmembrane, HYDROLASE
Deposited on 2008-04-14, released 2009-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltase-Glucoamylase
    Species: HOMO SAPIENS
    Gene: MGAM, MGA, MGAML
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43451 (Start-867)
      • expression tag (868-869)
    Domains in SCOPe 2.07: d3ctta1, d3ctta2, d3ctta3, d3ctta4, d3ctta5
  • Heterogens: NAG, SO4, 3CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cttA (A:)
    saecpvvnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvn
    tnagftarlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfs
    gnaaasltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvygl
    gehvhqqyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsna
    mevvlqpapaityrtiggildfyvflgntpeqvvqeyleligrpalpsywalgfhlsrye
    ygtldnmrevvernraaqlpydvqhadidymderrdftydsvdfkgfpefvnelhnngqk
    lviivdpaisnnsssskpygpydrgsdmkiwvnssdgvtpligevwpgqtvfpdytnpnc
    avwwtkefelfhnqvefdgiwidmnevsnfvdgsvsgcstnnlnnppftprildgylfck
    tlcmdavqhwgkqydihnlygysmavataeaaktvfpnkrsfiltrstfagsgkfaahwl
    gdntatwddlrwsipgvlefnlfgipmvgpdicgfaldtpeelcrrwmqlgafypfsrnh
    ngqgykdqdpasfgadslllnssrhylnirytllpylytlffrahsrgdtvarpllhefy
    ednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqvrwrkqkvemel
    pgdkiglhlrggyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtva
    nkvyllcefsvtqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsp
    tvtydsnlkvaiitdidlllgeaytvewah
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cttA (A:)
    vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft
    arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas
    ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq
    qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq
    papaityrtiggildfyvflgntpeqvvqeyleligrpalpsywalgfhlsryeygtldn
    mrevvernraaqlpydvqhadidymderrdftydsvdfkgfpefvnelhnngqklviivd
    paisnnsssskpygpydrgsdmkiwvnssdgvtpligevwpgqtvfpdytnpncavwwtk
    efelfhnqvefdgiwidmnevsnfvdgsvsgcstnnlnnppftprildgylfcktlcmda
    vqhwgkqydihnlygysmavataeaaktvfpnkrsfiltrstfagsgkfaahwlgdntat
    wddlrwsipgvlefnlfgipmvgpdicgfaldtpeelcrrwmqlgafypfsrnhngqgyk
    dqdpasfgadslllnssrhylnirytllpylytlffrahsrgdtvarpllhefyednstw
    dvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqvrwrkqkvemelpgdkig
    lhlrggyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyll
    cefsvtqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpssptvtydsnl
    kvaiitdidlllgeaytvewah