PDB entry 3ctq

View 3ctq on RCSB PDB site
Description: Structure of MAP kinase p38 in complex with a 1-o-tolyl-1,2,3-triazole-4-carboxamide
Class: transferase
Keywords: Two lobe kinase fold, N-terminal beta-sheet, C-terminal alpha-helix, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2008-04-14, released 2008-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.23
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539 (0-347)
      • conflict (9)
      • conflict (43)
      • conflict (115)
      • conflict (258)
    Domains in SCOPe 2.06: d3ctqa_
  • Heterogens: 337, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ctqA (A:)
    rptfyrqelaktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcakltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
    trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
    ellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
    hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctqA (A:)
    rptfyrqelaktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcakltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgvatrwyrapeimln
    wmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesar
    nyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpdd
    epvadpydqsfesrdllidewksltydevisfvppp