PDB entry 3ctn

View 3ctn on RCSB PDB site
Description: structure of calcium-saturated cardiac troponin c, nmr, 30 structures
Class: calcium-binding protein
Keywords: cardiac, muscle, regulatory, calcium-binding protein
Deposited on 1997-05-08, released 1998-05-13
The last revision prior to the SCOP 1.73 freeze date was dated 1998-05-13, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: GALLUS GALLUS
    Gene: CTNC(A-CYS)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d3ctna_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ctnA (A:)
    kddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdgdknnd
    gridydeflefmkgve