PDB entry 3ctn

View 3ctn on RCSB PDB site
Description: structure of calcium-saturated cardiac troponin c, nmr, 30 structures
Deposited on 1997-05-08, released 1998-05-13
The last revision prior to the SCOP 1.69 freeze date was dated 1998-05-13, with a file datestamp of 1998-05-13.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d3ctn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ctn_ (-)
    kddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdgdknnd
    gridydeflefmkgve