PDB entry 3ctm

View 3ctm on RCSB PDB site
Description: Crystal Structure of a Carbonyl Reductase from Candida Parapsilosis with anti-Prelog Stereo-specificity
Class: oxidoreductase
Keywords: alcohol dehydrogenase, Candida parapsilosis, short-chain dehydrogenases/reductases (SDR), X-ray crystallography, OXIDOREDUCTASE
Deposited on 2008-04-14, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.208
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonyl reductase
    Species: Candida Parapsilosis
    Gene: DQ675534
    Database cross-references and differences (RAF-indexed):
    • PDB 3CTM
    Domains in SCOPe 2.07: d3ctma_
  • Chain 'B':
    Compound: carbonyl reductase
    Species: Candida Parapsilosis
    Gene: DQ675534
    Database cross-references and differences (RAF-indexed):
    • PDB 3CTM (0-278)
    Domains in SCOPe 2.07: d3ctmb_
  • Chain 'C':
    Compound: carbonyl reductase
    Species: Candida Parapsilosis
    Gene: DQ675534
    Database cross-references and differences (RAF-indexed):
    • PDB 3CTM
    Domains in SCOPe 2.07: d3ctmc_
  • Chain 'D':
    Compound: carbonyl reductase
    Species: Candida Parapsilosis
    Gene: DQ675534
    Database cross-references and differences (RAF-indexed):
    • PDB 3CTM (Start-278)
    Domains in SCOPe 2.07: d3ctmd_
  • Chain 'E':
    Compound: carbonyl reductase
    Species: Candida Parapsilosis
    Gene: DQ675534
    Database cross-references and differences (RAF-indexed):
    • PDB 3CTM
    Domains in SCOPe 2.07: d3ctme_
  • Chain 'F':
    Compound: carbonyl reductase
    Species: Candida Parapsilosis
    Gene: DQ675534
    Database cross-references and differences (RAF-indexed):
    • PDB 3CTM (Start-278)
    Domains in SCOPe 2.07: d3ctmf_
  • Chain 'G':
    Compound: carbonyl reductase
    Species: Candida Parapsilosis
    Gene: DQ675534
    Database cross-references and differences (RAF-indexed):
    • PDB 3CTM
    Domains in SCOPe 2.07: d3ctmg_
  • Chain 'H':
    Compound: carbonyl reductase
    Species: Candida Parapsilosis
    Gene: DQ675534
    Database cross-references and differences (RAF-indexed):
    • PDB 3CTM (Start-278)
    Domains in SCOPe 2.07: d3ctmh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ctmA (A:)
    mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
    vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
    vtwtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivni
    pqlqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltp
    lgregltqelvggylylasnastfttgsdvvidggytcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctmA (A:)
    geiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagadv
    aiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanagv
    twtqeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivqlqap
    yntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplgregl
    tqelvggylylasnastfttgsdvvidggytc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ctmB (B:)
    mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
    vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
    vtwtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivni
    pqlqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltp
    lgregltqelvggylylasnastfttgsdvvidggytcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctmB (B:)
    mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
    vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
    vtwtqgpeidkiisvdlngvyycshnigkifkkngkgsliitssisgkivnipqlqapyn
    takaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplgregltq
    elvggylylasnastfttgsdvvidggytcp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ctmC (C:)
    mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
    vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
    vtwtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivni
    pqlqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltp
    lgregltqelvggylylasnastfttgsdvvidggytcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctmC (C:)
    eiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagadva
    iwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanagvt
    wvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkiqlqapyntakaa
    cthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplgregltqelvgg
    ylylasnastfttgsdvvidggyt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ctmD (D:)
    mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
    vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
    vtwtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivni
    pqlqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltp
    lgregltqelvggylylasnastfttgsdvvidggytcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctmD (D:)
    eiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagadva
    iwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanagvt
    wtqgpeidkiisvdlngvyycshnigkifkkngkgsliitssisgkivnipqlqapynta
    kaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplgregltqel
    vggylylasnastfttgsdvvidggytcp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ctmE (E:)
    mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
    vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
    vtwtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivni
    pqlqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltp
    lgregltqelvggylylasnastfttgsdvvidggytcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctmE (E:)
    eiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagadva
    iwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanagvt
    wtdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkiqlqapyntakaa
    cthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplgregltqelvgg
    ylylasnastfttgsdvvidggytc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ctmF (F:)
    mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
    vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
    vtwtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivni
    pqlqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltp
    lgregltqelvggylylasnastfttgsdvvidggytcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctmF (F:)
    eiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagadva
    iwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanagvt
    wtqgpenkiisvdlngvyycshnigkifkkngkgsliitssisgkivnipqlqapyntak
    aacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplgregltqelv
    ggylylasnastfttgsdvvidggytcp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ctmG (G:)
    mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
    vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
    vtwtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivni
    pqlqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltp
    lgregltqelvggylylasnastfttgsdvvidggytcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctmG (G:)
    eiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagadva
    iwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanagvt
    wtvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkiqlqapyntaka
    acthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplgregltqelvg
    gylylasnastfttgsdvvidggyt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ctmH (H:)
    mgeiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagad
    vaiwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanag
    vtwtqgpeidvdnydswnkiisvdlngvyycshnigkifkkngkgsliitssisgkivni
    pqlqapyntakaacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltp
    lgregltqelvggylylasnastfttgsdvvidggytcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctmH (H:)
    eiesycnkelgplptkaptlsknvldlfslkgkvasvtgssggigwavaeayaqagadva
    iwynshpadekaehlqktygvhskaykcnisdpksveetisqqekdfgtidvfvanagvt
    wtqgpeikiisvdlngvyycshnigkifkkngkgsliitssisgkivnipqlqapyntak
    aacthlakslaiewapfarvntispgyidtditdfaskdmkakwwqltplgregltqelv
    ggylylasnastfttgsdvvidggytcp