PDB entry 3ctk

View 3ctk on RCSB PDB site
Description: Crystal structure of the type 1 RIP bouganin
Class: hydrolase
Keywords: alpha-beta protein, HYDROLASE
Deposited on 2008-04-14, released 2008-05-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rRNA N-glycosidase
    Species: Bougainvillea spectabilis
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ctka1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ctkA (A:)
yntvsfnlgeayeyptfiqdlrnelakgtpvcqlpvtlqtiaddkrfvlvditttskktv
kvaidvtdvyvvgyqdkwdgkdravfldkvptvatsklfpgvtnrvtltfdgsyqklvna
akvdrkdlelgvyklefsieaihgktingqeiakffliviqmvseaarfkyietevvdrg
lygsfkpnfkvlnlennwgdisdaihksspqcttinpalqlispsndpwvvnkvsqispd
mgilkfks