PDB entry 3cth

View 3cth on RCSB PDB site
Description: Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met in complex with a aminopyridine based inhibitor
Class: transferase
Keywords: receptor tyrosine kinase, signal transduction, grb2, shc, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene, transferase, transmembrane, tyrosine-protein kinase
Deposited on 2008-04-14, released 2008-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: HOMO SAPIENS
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-313)
      • engineered (147)
    Domains in SCOPe 2.06: d3ctha_
  • Heterogens: 319, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cthA (A:)
    gantvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cthA (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavks
    lnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirn
    ethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgnktgakl
    pvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqp
    eycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk