PDB entry 3ctf

View 3ctf on RCSB PDB site
Description: Crystal structure of oxidized GRX2
Class: oxidoreductase
Keywords: OXIDIZED FORM, Electron transport, Mitochondrion, Redox-active center, Transit peptide, Transport, OXIDOREDUCTASE
Deposited on 2008-04-14, released 2008-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaredoxin-2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GRX2, TTR, TTR1, YDR513W, D9719.17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ctfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ctfA (A:)
mgsshhhhhhssglvprgshmvsqetvahvkdligqkevfvaaktycpyckatlstlfqe
lnvpkskalvleldemsngseiqdaleeisgqktvpnvyingkhiggnsdletlkkngkl
aeilkpvfq

    Sequence, based on observed residues (ATOM records): (download) 
    >3ctfA (A:)
vsqetvahvkdligqkevfvaaktycpyckatlstlfqelnvpkskalvleldemsngse
iqdaleeisgqktvpnvyingkhiggnsdletlkkngklaeilkpvfq