PDB entry 3ct4

View 3ct4 on RCSB PDB site
Description: Structure of Dha-kinase subunit DhaK from L. Lactis
Class: transferase
Keywords: PTS dependent, dihydroxyacetone kinase subunit, tranferase, covalently linked 2HA, Glycerol metabolism, Transferase
Deposited on 2008-04-11, released 2008-10-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit dhaK
    Species: Lactococcus lactis subsp. lactis [TaxId:1360]
    Gene: dhaK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CIV8
      • see remark 999 (58)
    Domains in SCOPe 2.03: d3ct4a_
  • Chain 'B':
    Compound: PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit dhaK
    Species: Lactococcus lactis subsp. lactis [TaxId:1360]
    Gene: dhaK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CIV8
      • see remark 999 (58)
    Domains in SCOPe 2.03: d3ct4b_
  • Chain 'C':
    Compound: PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit dhaK
    Species: Lactococcus lactis subsp. lactis [TaxId:1360]
    Gene: dhaK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CIV8
      • see remark 999 (58)
    Domains in SCOPe 2.03: d3ct4c_
  • Heterogens: 2HA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ct4A (A:)
    msdekiinqpqdvvsemldgltyaygdliekvpdfeiiqrkspksgkvalvsgggsghep
    ahagfvgegmlsaavcgaiftsptpdqiyeaiksadegagvlliiknylgdvmnfemare
    maemeeikveqiivdddiavenslytqgrrgvagtvlvhkilgaaahqeasldeikdlad
    kvvkniktiglalsaatvpevgkpgfvlddneieygvgihsepgyrrekmktsyelatel
    vgklkeefkfeagqkygilvngmgatplmeqfifmndvakllteenieilfkkvgnymts
    idmaglsltmikleddqwlknlnedvktiswg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ct4A (A:)
    ekiinqpqdvvsemldgltyaygdliekvpdfeiiqrkspksgkvalvsgggsghepaha
    gfvgegmlsaavcgaiftsptpdqiyeaiksadegagvlliiknylgdvmnfemaremae
    meeikveqiivdddiavenslytqgrrgvagtvlvhkilgaaahqeasldeikdladkvv
    kniktiglalsaatvpdneieygvgihsepgyrrekmktsyelatelvgklkeefkfeag
    qkygilvngmgatplmeqfifmndvakllteenieilfkkvgnymtsidmaglsltmikl
    eddqwlknlnedvktisw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ct4B (B:)
    msdekiinqpqdvvsemldgltyaygdliekvpdfeiiqrkspksgkvalvsgggsghep
    ahagfvgegmlsaavcgaiftsptpdqiyeaiksadegagvlliiknylgdvmnfemare
    maemeeikveqiivdddiavenslytqgrrgvagtvlvhkilgaaahqeasldeikdlad
    kvvkniktiglalsaatvpevgkpgfvlddneieygvgihsepgyrrekmktsyelatel
    vgklkeefkfeagqkygilvngmgatplmeqfifmndvakllteenieilfkkvgnymts
    idmaglsltmikleddqwlknlnedvktiswg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ct4B (B:)
    ekiinqpqdvvsemldgltyaygdliekvpdfeiiqrkspksgkvalvsgggsghepaha
    gfvgegmlsaavcgaiftsptpdqiyeaiksadegagvlliiknylgdvmnfemaremae
    meeikveqiivdddiavenslytqgrrgvagtvlvhkilgaaahqeasldeikdladkvv
    kniktiglalsaatvpdneieygvgihsepgyrrekmktsyelatelvgklkeefkfeag
    qkygilvngmgatplmeqfifmndvakllteenieilfkkvgnymtsidmaglsltmikl
    eddqwlknlnedvktisw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ct4C (C:)
    msdekiinqpqdvvsemldgltyaygdliekvpdfeiiqrkspksgkvalvsgggsghep
    ahagfvgegmlsaavcgaiftsptpdqiyeaiksadegagvlliiknylgdvmnfemare
    maemeeikveqiivdddiavenslytqgrrgvagtvlvhkilgaaahqeasldeikdlad
    kvvkniktiglalsaatvpevgkpgfvlddneieygvgihsepgyrrekmktsyelatel
    vgklkeefkfeagqkygilvngmgatplmeqfifmndvakllteenieilfkkvgnymts
    idmaglsltmikleddqwlknlnedvktiswg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ct4C (C:)
    ekiinqpqdvvsemldgltyaygdliekvpdfeiiqrkspksgkvalvsgggsghepaha
    gfvgegmlsaavcgaiftsptpdqiyeaiksadegagvlliiknylgdvmnfemaremae
    meeikveqiivdddiavenslytqgrrgvagtvlvhkilgaaahqeasldeikdladkvv
    kniktiglalsaatvpdneieygvgihsepgyrrekmktsyelatelvgklkeefkfeag
    qkygilvngmgatplmeqfifmndvakllteenieilfkkvgnymtsidmaglsltmikl
    eddqwlknlnedvktisw