PDB entry 3ct1

View 3ct1 on RCSB PDB site
Description: crystal and cryoem structural studies of a cell wall degrading enzyme in the bacteriophage phi29 tail
Deposited on 2008-04-11, released 2008-07-01
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Morphogenesis protein 1
    Species: Bacteriophage phi-29
    Gene: 13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15132 (0-158)
      • see remark 999 (88)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ct1A (A:)
    mvyvsnkyltmsemkvnaqyilnylssngwtkqaicgmlgnmqsestinpglwqnldegn
    tslgfglvqwtpasnyinwansqglpyknmdselkriiwevnnnaqwinlrdmtfkeyik
    stktprelamiflasyerpanpnqpergdqaeywyknls