PDB entry 3csy
View 3csy on RCSB PDB site
Description: Crystal structure of the trimeric prefusion Ebola virus glycoprotein in complex with a neutralizing antibody from a human survivor
Class: immune system/viral protein
Keywords: glycoprotein-antibody complex, IMMUNE SYSTEM-VIRAL PROTEIN COMPLEX
Deposited on
2008-04-10, released
2008-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-03-31, with a file datestamp of
2021-03-26.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.15
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Fab KZ52 heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Fab KZ52 light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Fab KZ52 heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Fab KZ52 light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Fab KZ52 heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Fab KZ52 light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: Fab KZ52 heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Fab KZ52 light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: Envelope glycoprotein GP1
Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
Gene: GP
Database cross-references and differences (RAF-indexed):
- Uniprot Q05320 (16-End)
- expression tag (15)
- engineered (26)
- engineered (214)
Domains in SCOPe 2.08: d3csyi1, d3csyi2 - Chain 'J':
Compound: Envelope glycoprotein GP2
Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
Gene: GP
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: Envelope glycoprotein GP1
Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
Gene: GP
Database cross-references and differences (RAF-indexed):
- Uniprot Q05320 (16-End)
- expression tag (15)
- engineered (26)
- engineered (214)
- Chain 'L':
Compound: Envelope glycoprotein GP2
Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
Gene: GP
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: Envelope glycoprotein GP1
Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
Gene: GP
Database cross-references and differences (RAF-indexed):
- Uniprot Q05320 (16-End)
- expression tag (15)
- engineered (26)
- engineered (214)
- Chain 'N':
Compound: Envelope glycoprotein GP2
Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
Gene: GP
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: Envelope glycoprotein GP1
Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
Gene: GP
Database cross-references and differences (RAF-indexed):
- Uniprot Q05320 (16-End)
- expression tag (15)
- engineered (26)
- engineered (214)
- Chain 'P':
Compound: Envelope glycoprotein GP2
Species: Ebola virus - Mayinga, Zaire, 1976 [TaxId:128952]
Gene: GP
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
Sequence, based on SEQRES records: (download)
>3csyI (I:)
ypydvpdyaiegrgarsiplgvihnsvlqvsdvdklvcrdklsstnqlrsvglnlegngv
atdvpsatkrwgfrsgvppkvvnyeagewaencynleikkpdgseclpaapdgirgfprc
ryvhkvsgtgpcagdfafhkegafflydrlastviyrgttfaegvvaflilpqakkdffs
shplrepvnatedpssgyysttiryqatgfgtneveylfevdnltyvqlesrftpqfllq
lnetiytsgkrsnttgkliwkvnpeidttigewafwetkknltrkirseelsftvvthhq
dtgeesassgklglitntiagvaglitggrrtrr
Sequence, based on observed residues (ATOM records): (download)
>3csyI (I:)
rsiplgvihnsvlqvsdvdklvcrdklsstnqlrsvglnlegngvatdvpsatkrwgfrs
gvppkvvnyeagewaencynleikkpdgseclpaapdgirgfprcryvhkvsgtgpcagd
fafhkegafflydrlastviyrgttfaegvvaflilpqaysttiryqatgfgtneveylf
evdnltyvqlesrftpqfllqlnetiytsgkrsnttgkliwkvnrkirseelsftv
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.
- Chain 'O':
No sequence available.
- Chain 'P':
No sequence available.