PDB entry 3csr

View 3csr on RCSB PDB site
Description: Crystal and cryoEM structural studies of a cell wall degrading enzyme in the bacteriophage phi29 tail
Deposited on 2008-04-10, released 2008-07-01
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Morphogenesis protein 1
    Species: Bacteriophage phi-29
    Gene: 13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15132 (0-158)
      • see remark 999 (88)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3csrA (A:)
mvyvsnkyltmsemkvnaqyilnylssngwtkqaicgmlgnmqsestinpglwqnldegn
tslgfglvqwtpasnyinwansqglpyknmdselkriiwevnnnaqwinlrdmtfkeyik
stktprelamiflasyerpanpnqpergdqaeywyknls