PDB entry 3csn

View 3csn on RCSB PDB site
Description: Structure of the Serratia marcescens hemophore receptor HasR in complex with its hemophore HasA
Class: membrane protein/heme binding protein
Keywords: outer membrane protein, beta-barrel, hemophore receptor, TonB box, Heme, Iron, Metal-binding, Secreted, MEMBRANE PROTEIN-HEME BINDING PROTEIN COMPLEX
Deposited on 2008-04-10, released 2009-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HasR protein
    Species: Serratia marcescens
    Gene: hasR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79AD2 (Start-864)
      • see remark 999 (644)
  • Chain 'B':
    Compound: HasR protein
    Species: Serratia marcescens
    Gene: hasR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79AD2 (Start-864)
      • see remark 999 (644)
  • Chain 'C':
    Compound: hemophore hasa
    Species: Serratia marcescens
    Gene: hasA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54450 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d3csnc1, d3csnc2
  • Chain 'D':
    Compound: hemophore hasa
    Species: Serratia marcescens
    Gene: hasA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54450 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d3csnd1, d3csnd2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3csnC (C:)
    mrgshhhhhhgirmrarypafsvnydssfggysihdylgqwastfgdvnhtngnvtdans
    ggfyggslsgsqyaisstanqvtafvaggnltytlfnepahtlygqldslsfgdglsggd
    tspysiqvpdvsfgglnlsslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsv
    nstfdqvaaatavgvqhadspellaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3csnC (C:)
    pafsvnydssfggysihdylgqwastfgdansggfyggslsgsqyaisstanqvtafvag
    gnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnlsslqaqghdg
    vvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3csnD (D:)
    mrgshhhhhhgirmrarypafsvnydssfggysihdylgqwastfgdvnhtngnvtdans
    ggfyggslsgsqyaisstanqvtafvaggnltytlfnepahtlygqldslsfgdglsggd
    tspysiqvpdvsfgglnlsslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsv
    nstfdqvaaatavgvqhadspellaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3csnD (D:)
    pafsvnydssfggysihdylgqwastfgdansggfyggslsgsqyaisstanqvtafvag
    gnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnlsslqaqghdg
    vvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaat