PDB entry 3csm

View 3csm on RCSB PDB site
Description: structure of yeast chorismate mutase with bound trp and an endooxabicyclic inhibitor
Class: complex (isomerase/peptide)
Keywords: CHORISMATE PYRUVATEMUTASE, ALLOSTERIC PROTEIN, COMPLEX (ISOMERASE-PEPTIDE), TRANSITION STATE ANALOG, COMPLEX (ISOMERASE-PEPTIDE) complex
Deposited on 1997-07-10, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.204
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3csma_
  • Chain 'B':
    Compound: chorismate mutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3csmb_
  • Heterogens: TRP, TSA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdpterrierritpeylvkiykeivip
    itkeveveyllrrlee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdpterritpeylvkiykeivipitke
    veveyllrrlee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3csmB (B:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdpterrierritpeylvkiykeivip
    itkeveveyllrrlee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3csmB (B:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdpterritpeylvkiykeivipitke
    veveyllrrlee