PDB entry 3csf

View 3csf on RCSB PDB site
Description: Crystal structure of PI3K p110gamma catalytical domain in complex with organoruthenium inhibitor DW2
Class: transferase
Keywords: PHOSPHOINOSITIDE 3-KINASE GAMMA, PI3K, Transferase
Deposited on 2008-04-09, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: HOMO SAPIENS
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3csfa1, d3csfa2, d3csfa3, d3csfa4
  • Heterogens: DW2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3csfA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3csfA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmqdfvlrvcgrd
    eylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkecdrkfrvkirgidipvl
    ptdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiyc
    gkqllyyvnlllidhrfllrrgeyvlhmwqisfnadkltsatnpdkensmsisilldnhp
    ialpkvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvk
    wgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvl
    hyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavil
    eaylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqns
    qlpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgdd
    lrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvg
    ntgfkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetg
    nlfhidfghlgervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnllii
    lfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwfl