PDB entry 3csd

View 3csd on RCSB PDB site
Description: Actinorhodin Polyketide Ketoreductase Mutant P94L bound to NADPH and the Inhibitor Emodin
Class: oxidoreductase
Keywords: Oxidoreductase, Antibiotic biosynthesis, NADP
Deposited on 2008-04-09, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ketoacyl reductase
    Species: STREPTOMYCES COELICOLOR
    Gene: actIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16544 (Start-280)
      • engineered (113)
    Domains in SCOPe 2.07: d3csda_
  • Chain 'B':
    Compound: Putative ketoacyl reductase
    Species: STREPTOMYCES COELICOLOR
    Gene: actIII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16544 (20-280)
      • expression tag (16-19)
      • engineered (113)
    Domains in SCOPe 2.07: d3csdb1, d3csdb2
  • Heterogens: NDP, EMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3csdA (A:)
    mgsshhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcarge
    eglrttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggata
    eladelwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysas
    khgvvgftkalglelartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritar
    vpigryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >3csdA (A:)
    sevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdvr
    svpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnltgvfrvtkqv
    lkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvnav
    cpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpgaa
    avtaqalnvcgglgny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3csdB (B:)
    mgsshhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcarge
    eglrttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggata
    eladelwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysas
    khgvvgftkalglelartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritar
    vpigryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >3csdB (B:)
    rgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagve
    adgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnlt
    gvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglela
    rtgitvnavcpgfvetpmaasvrehteeafdritarvpigryvqpsevaemvayligpga
    aavtaqalnvcgglgny