PDB entry 3cs9

View 3cs9 on RCSB PDB site
Description: Human ABL kinase in complex with nilotinib
Class: transferase
Keywords: nilotinib, amn107, kinase, Abl, Alternative splicing, ATP-binding, Cell adhesion, Chromosomal rearrangement, Cytoplasm, Cytoskeleton, Lipoprotein, Magnesium, Manganese, Metal-binding, Myristate, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, ABL KINASE WT IN COMPLEX WITH NVP-AMN107
Deposited on 2008-04-09, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.2
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cs9a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cs9b_
  • Chain 'C':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cs9c_
  • Chain 'D':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cs9d_
  • Heterogens: NIL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cs9A (A:)
    gamdpspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveef
    lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllym
    atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
    kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
    cpekvyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cs9A (A:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlkeveeflkeaavmkeikhp
    nlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylek
    knfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkf
    siksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracw
    qwnpsdrpsfaeihqafetmfqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cs9B (B:)
    gamdpspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveef
    lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllym
    atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
    kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
    cpekvyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cs9B (B:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktltmeveeflkeaavmkeikh
    pnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameyle
    kknfihrdlaarnclvgenhlvkvadfgpikwtapeslaynkfsiksdvwafgvllweia
    tygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeihqaf
    etmfqes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cs9C (C:)
    gamdpspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveef
    lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllym
    atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
    kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
    cpekvyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cs9C (C:)
    ydkwemertditmkhklgggqygevyegvwkkysltvavktleveeflkeaavmkeikhp
    nlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylek
    knfihrdlaarnclvgenhlvkvadfgpikwtapeslaynkfsiksdvwafgvllweiat
    ygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeihqafe
    tmf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cs9D (D:)
    gamdpspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveef
    lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllym
    atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
    kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
    cpekvyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cs9D (D:)
    dkwemertditmkhklgggqygevyegvwtvavktlkedtmeveeflkeaavmkeikhpn
    lvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekk
    nfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfs
    iksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwq
    wnpsdrpsfaeihqafetmfqes