PDB entry 3cs0

View 3cs0 on RCSB PDB site
Description: Crystal structure of DegP24
Class: hydrolase
Keywords: DegP, HtrA, protease, chaperone, PDZ, outer membrane protein, OMP, periplasm, HYDROLASE
Deposited on 2008-04-08, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.212
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease do
    Species: ESCHERICHIA COLI
    Gene: degP, htrA, ptd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cs0a1, d3cs0a2, d3cs0a3
  • Chain 'B':
    Compound: pentapeptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3CS0 (0-4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cs0A (A:)
    aetssattaqqmpslapmlekvmpsvvsinvegsttvntprmprnfqqffgddspfcqeg
    spfqsspfcqggqggngggqqqkfmalgsgviidadkgyvvtnnhvvdnatvikvqlsdg
    rkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglgetvtsg
    ivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggnigigf
    aipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaa
    kagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssqn
    qvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniae
    lrkvldskpsvlalniqrgdstiyllmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cs0A (A:)
    qmpslapmlekvmpsvvsinvegstqkfmalgsgviidadkgyvvtnnhvvdnatvikvq
    lsdgrkfdakmvgkdprsdialiqiqnpknltaikmadsdalrvgdytvaignpfglget
    vtsgivsalgrsglnaenyenfiqtdaainrgnsggalvnlngeligintailapdggni
    gigfaipsnmvknltsqmveygqvkrgelgimgtelnselakamkvdaqrgafvsqvlpn
    ssaakagikagdvitslngkpissfaalraqvgtmpvgskltlgllrdgkqvnvnlelqq
    ssqnqvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavk
    niaelrkvldskpsvlalniqrgdstiyllmq
    

  • Chain 'B':
    No sequence available.