PDB entry 3crz

View 3crz on RCSB PDB site
Description: Ferredoxin-NADP Reductase
Class: oxidoreductase
Keywords: FAD-binding FR-type domain, OXIDOREDUCTASE
Deposited on 2008-04-08, released 2008-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin--nadp+ reductase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3crza1, d3crza2
  • Heterogens: NAP, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3crzA (A:)
    snlytervlsvhhwndtlfsfkttrnpglrfktgqfvmiglevdgrplmraysiaspnye
    ehleffsikvpdgpltsrlqhlkegdelmvsrkptgtlvhddllpgkhlyllstgtgmap
    flsviqdpetyeryekvilvhgvrwvselayadfitkvlpeheyfgdqvkekliyyplvt
    repfrnqgrqtdlmrsgklfediglppmnpqddramicgspsmleetsavldsfglkisp
    rmgepgdylierafvek