PDB entry 3cro

View 3cro on RCSB PDB site
Description: the phage 434 cro/or1 complex at 2.5 angstroms resolution
Class: transcription/DNA
Keywords: protein-DNA complex, double helix
Deposited on 1990-07-06, released 1991-10-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*ap*gp*tp*ap*cp*ap*ap*ap*cp*tp*tp*tp*cp*tp*tp*g p*tp*ap*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*tp*ap*cp*ap*ap*gp*ap*ap*ap*gp*tp*tp*tp*gp*t p*ap*cp*t)-3')
  • Chain 'L':
    Compound: protein (434 cro)
    Species: Bacteriophage 434
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3crol_
  • Chain 'R':
    Compound: protein (434 cro)
    Species: Bacteriophage 434
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cror_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3croL (L:)
    mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
    lqygtkrgkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3croL (L:)
    mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
    lqygtk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3croR (R:)
    mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
    lqygtkrgkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3croR (R:)
    mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
    lqyg