PDB entry 3cro

View 3cro on RCSB PDB site
Description: the phage 434 cro/or1 complex at 2.5 angstroms resolution
Deposited on 1990-07-06, released 1991-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Domains in SCOP 1.57: d3crol_
  • Chain 'R':
    Domains in SCOP 1.57: d3cror_

PDB Chain Sequences:

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3croL (L:)
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygtk

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3croR (R:)
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqyg