PDB entry 3crh

View 3crh on RCSB PDB site
Description: Crystal structure of human fibroblast growth factor-1 with mutations Glu81Ser and Lys101Ala
Class: hormone
Keywords: crystal packing, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, HORMONE
Deposited on 2008-04-07, released 2009-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.183
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (86)
      • engineered (106)
    Domains in SCOPe 2.06: d3crha1, d3crha2
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (86)
      • engineered (106)
    Domains in SCOPe 2.06: d3crhb1, d3crhb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3crhA (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpnseclflerleenhyntyiskahaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3crhA (A:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpnseclflerleenhyntyiskahaeknwfvglkkng
    sckrgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3crhB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpnseclflerleenhyntyiskahaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3crhB (B:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpnseclflerleenhyntyiskahaeknwfvglkkng
    sckrgprthygqkailflplpv