PDB entry 3cre

View 3cre on RCSB PDB site
Description: Electron Microscopy model of the Saf Pilus- Type A
Class: membrane protein
Keywords: SafA protein polymer, Type A Saf Pilus, Fibril Protein, MEMBRANE PROTEIN
Deposited on 2008-04-07, released 2008-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 17 Å
R-factor: N/A
AEROSPACI score: -0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein
    Species: SALMONELLA TYPHIMURIUM
    Gene: safA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3crea1
  • Chain 'B':
    Compound: Outer membrane protein
    Species: SALMONELLA TYPHIMURIUM
    Gene: safA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3creb1
  • Chain 'C':
    Compound: Outer membrane protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3creA (A:)
    dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
    gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
    yqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3creB (B:)
    gsflpnseqqksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvr
    gisnnvvdstgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldiv
    ltgpaqnvtadtypitldvvgyqp
    

  • Chain 'C':
    No sequence available.