PDB entry 3cr7

View 3cr7 on RCSB PDB site
Description: Crystal structure of N-terminal truncation of APS Kinase from Penicillium chrysogenum: Ternary structure with ADP and PAPS
Class: transferase
Keywords: APS kinase, Adenylylsulfate kinase, Transferase, sulfate metabolism, Nucleotide 2 kinase, Amino-acid biosynthesis, ATP-binding, Cysteine biosynthesis, Methionine biosynthesis, Nucleotide-binding, Phosphoprotein
Deposited on 2008-04-04, released 2009-02-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylyl-sulfate kinase
    Species: Penicillium chrysogenum [TaxId:5076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cr7a_
  • Chain 'B':
    Compound: Adenylyl-sulfate kinase
    Species: Penicillium chrysogenum [TaxId:5076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cr7b_
  • Chain 'C':
    Compound: Adenylyl-sulfate kinase
    Species: Penicillium chrysogenum [TaxId:5076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cr7c_
  • Chain 'D':
    Compound: Adenylyl-sulfate kinase
    Species: Penicillium chrysogenum [TaxId:5076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cr7d_
  • Heterogens: CL, ADP, PPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cr7A (A:)
    qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
    nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpgeetglpfvevyvdvpv
    evaeqrdpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldt
    kgylpakkelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cr7A (A:)
    rgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrnen
    irriaevaklfadsnsiaitsfispyrkdrdtarqlhevtglpfvevyvdvpvevaeqrd
    pkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldtkgylpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cr7B (B:)
    qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
    nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpgeetglpfvevyvdvpv
    evaeqrdpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldt
    kgylpakkelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cr7B (B:)
    rgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrnen
    irriaevaklfadsnsiaitsfispyrkdrdtarqlhevetglpfvevyvdvpvevaeqr
    dpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldtkgylpa
    k
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cr7C (C:)
    qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
    nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpgeetglpfvevyvdvpv
    evaeqrdpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldt
    kgylpakkelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cr7C (C:)
    qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
    nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevtglpfvevyvdvpvevaeqr
    dpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldtkgyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cr7D (D:)
    qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
    nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpgeetglpfvevyvdvpv
    evaeqrdpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldt
    kgylpakkelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cr7D (D:)
    qrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirfglnkdlgfseadrne
    nirriaevaklfadsnsiaitsfispyrkdrdtarqlhevaeetglpfvevyvdvpveva
    eqrdpkglykkaregvikeftgisapyeapanpevhvknyelpvqdavkqiidyldtkgy
    lpa