PDB entry 3cr6

View 3cr6 on RCSB PDB site
Description: Crystal Structure of the R132K:R111L:A32E Mutant of Cellular Retinoic Acid Binding Protein Type II Complexed with C15-aldehyde (a retinal analog) at 1.22 Anstrom resolution.
Class: transport protein
Keywords: CRABPII, retinal, schiff base, protonated schiff base, PSB, C15-aldehyde, retinoic acid, retinoid, Cytoplasm, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on 2008-04-04, released 2009-03-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: 0.188
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cellular retinoic acid-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CRABP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29373 (0-136)
    • engineered (31)
    • engineered (110)
    • engineered (131)
  Domains in SCOPe 2.03: d3cr6a_
• Heterogens: LSR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cr6A (A:)
  pnfsgnwkiirsenfeellkvlgvnvmlrkievaaaskpaveikqegdtfyiktsttvrt
  teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
  ltmtaddvvctkvyvre