PDB entry 3cr2

View 3cr2 on RCSB PDB site
Description: X-ray structure of bovine Zn(2+),Ca(2+)-S100B
Class: metal binding protein
Keywords: EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN
Deposited on 2008-04-04, released 2008-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: BOS TAURUS
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cr2a_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cr2A (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cr2A (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffe