PDB entry 3cqz

View 3cqz on RCSB PDB site
Description: Crystal structure of 10 subunit RNA polymerase II in complex with the inhibitor alpha-amanitin
Class: transcription/toxin
Keywords: transcription-toxin complex, alpha amanitin, toxin, inhibitor, polymerase, transferase, DNA binding, zinc-finger, phosphoprotein, transcription
Deposited on 2008-04-03, released 2008-07-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase II subunit RPB1
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cqza1
  • Chain 'B':
    Compound: DNA-directed RNA polymerase II subunit RPB2
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cqzb_
  • Chain 'C':
    Compound: DNA-directed RNA polymerase II subunit RPB3
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC1
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC2
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cqzf1
  • Chain 'H':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC3
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cqzh_
  • Chain 'I':
    Compound: DNA-directed RNA polymerase II subunit RPB9
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC5
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cqzj_
  • Chain 'K':
    Compound: DNA-directed RNA polymerase II subunit RPB11
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cqzk_
  • Chain 'L':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC4
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cqzl1
  • Chain 'M':
    Compound: alpha-amanitin
    Species: AMANITA PHALLOIDES, synthetic [TaxId:67723]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cqzA (A:)
    mvgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgs
    idrnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehne
    lmrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglk
    lvgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclp
    vppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhv
    atymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnle
    ldqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskr
    agdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspyna
    dfdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtf
    ieldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllsp
    kdngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhn
    gfstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvr
    flneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfv
    drtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrr
    lvkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvd
    llntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvni
    rriiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfcc
    llrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmt
    lntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieh
    ttlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldra
    amndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhml
    kkientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvp
    gidptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqgg
    ltsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtga
    fdvmideeslvkympeqkiteiedgqdggvtpysnesglvnadldvkdelmfsplvdsgs
    ndamaggftayggadygeatspfgaygeaptspgfgvsspgfsptsptysptspayspts
    psysptspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsys
    ptspsysptspsysptspsysptspsysptspsysptspaysptspsysptspsysptsp
    sysptspsysptspnysptspsysptspgyspgspayspkqdeqkhnenensr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cqzA (A:)
    yssaplrtvkevqfglfspeevraisvakirfpetakigglndprlgsidrnlkcqtcqe
    gmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelmrqalaikdsk
    krfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklvgswkkepelr
    vlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrptfkladilkani
    sletlehngaphhaieeaesllqfhvatymdfsartvisgdpnleldqvgvpksiaktlt
    ypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqygwkverh
    imdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnlhvpqse
    etraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnmlywvpd
    wdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliidgqiifg
    vvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdtiadgpt
    mreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardkagrlaev
    nlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfskddyspe
    skgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledimvhydnt
    trnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtldpslles
    gseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqqtfhidh
    tkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatrrvlqey
    rltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlntfhfagvaskkvt
    sgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyyd
    pdprstvipedeeiiqlhfslldqqspwllrleldraamndkdltmgqvgerikqtfknd
    lfviwsedndekliircrvveaeedhmlkkientmlenitlrgveniervvmmkydrkvp
    sptgeyvkepewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykev
    ynviasdgsyvnyrhmallvdvmttqggltsvtrhgmrcsfeetveilfeagasaelddc
    rgvsenvilgqmapigtgafdvmideesl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cqzB (B:)
    msdlansekyydedpygfedesapitaedswavisaffrekglvsqqldsfnqfvdytlq
    diicedstlileqlaqhttesdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlr
    nltyssglfvdvkkrtyeaidvpgrelkyeliaeeseddsesgkvfigrlpimlrskncy
    lseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaei
    rsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeileh
    icydvndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkef
    lphitqlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktl
    fkkltkdifrymqrtveeahdfnmklainaktitsglkyalatgnwgeqkkamssragvs
    qvlnrytysstlshlrrtntpigrdgklakprqlhnthwglvcpaetpegqacglvknls
    lmscisvgtdpmpiitflsewgmepledyvphqspdatrvfvngvwhgvhrnparlmetl
    rtlrrkgdinpevsmirdirekelkiftdagrvyrplfiveddeslghkelkvrkghiak
    lmateyqdieggfedveeytwssllneglveyidaeeeesiliamqpedlepaeaneend
    ldvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgv
    fltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaivaiacysgynqedsmi
    mnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrmkhgtydkldddglia
    pgvrvsgedviigkttpispdeeelgqrtayhskrdastplrstengivdqvlvttnqdg
    lkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaipsr
    mtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtgkk
    lmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerdcmia
    hgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaa
    kllfqelmamnitprlytdrsrdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cqzB (B:)
    desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstleisfgkiyvt
    kpmvnesdgvthalypqearlrnltyssglfvdvkkesgkvfigrlpimlrskncylsea
    tesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsal
    ekgistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvnd
    wqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitql
    egfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkd
    ifrlainaktitsglkyalatgnwagvsqvlnrytysstlshlrrtntpigrdgklakpr
    qlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepledyvph
    qspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkiftdagr
    vyrplfiveddeslghkelkvrkghiaklmateyqdveeytwssllneglveyidaeeee
    siliamqpedlepdvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsprnt
    yqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaivaia
    cysgynqedsmimnqssidrglfrslffrsymdqekkitetfekpqrtrmkhgtydkldd
    dgliapgvrvsgedviigkttpskrdastplrstengivdqvlvttnqdglkfvkvrvrt
    tkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecl
    lskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgpt
    yyqrlrhmvglrfgemerdcmiahgaasflkerlmeasdafrvhicgicglmtviahnqf
    eckgcdnkidiyqihipyaakllfqelmamnitprlytdrs
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cqzF (F:)
    msdyeeafndgnenfedfdvehfsdeetyeekpqfkdgettdangktivtggngpedfqq
    heqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplri
    amkelaekkiplvirrylpdgsfedwsveelivdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cqzF (F:)
    kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
    lvirrylpdgsfedwsveelivdl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cqzH (H:)
    msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
    sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
    llmrlegnyrnlnnlkqenayllirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cqzH (H:)
    sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
    trswrppqagdrsladdydyvmygtaykfeevskvyysfggllmrleenayllirr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3cqzJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cqzJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3cqzK (K:)
    mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
    ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtlaaddaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cqzK (K:)
    napdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaay
    kvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3cqzL (L:)
    msregfqiptnldaaaagtsqartatlkyicaecssklslsrtdavrckdcghrillkar
    tkrlvqfear
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cqzL (L:)
    tlkyicaecssklslsrtdavrccghrillkartkrlvqfear
    

  • Chain 'M':
    No sequence available.