PDB entry 3cqu

View 3cqu on RCSB PDB site
Description: Crystal Structure of Akt-1 complexed with substrate peptide and inhibitor
Class: transferase
Keywords: Kinase, Apoptosis, ATP-binding, Carbohydrate metabolism, Cytoplasm, Glucose metabolism, Glycogen biosynthesis, Glycogen metabolism, Membrane, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Sugar transport, Transferase, Translation regulation, Transport, Alternative splicing, Wnt signaling pathway
Deposited on 2008-04-03, released 2008-05-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAC-alpha serine/threonine-protein kinase
    Species: HOMO SAPIENS
    Gene: AKT1, PKB, RAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31749 (5-End)
      • engineered (334)
      • variant (339)
    Domains in SCOPe 2.05: d3cqua_
  • Chain 'C':
    Compound: Glycogen synthase kinase-3 beta
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CQU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cquA (A:)
    gamdprvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtlte
    nrvlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeiv
    saldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylap
    evledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaks
    llsgllkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryf
    deeftaqmititppdqddsmecvdserrphfpqfdysassta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cquA (A:)
    rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
    nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
    lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
    ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
    lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
    aqmserrphfpqfdysass
    

  • Chain 'C':
    No sequence available.