PDB entry 3cqb

View 3cqb on RCSB PDB site
Description: Crystal structure of heat shock protein HtpX domain from Vibrio parahaemolyticus RIMD 2210633
Deposited on 2008-04-02, released 2008-05-27
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.154
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable protease htpX homolog
    Species: Vibrio parahaemolyticus RIMD 2210633
    Gene: htpX, VP1118
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87QN1 (3-End)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Probable protease htpX homolog
    Species: Vibrio parahaemolyticus RIMD 2210633
    Gene: htpX, VP1118
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, NA, EDO, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3cqbA (A:)
    snaskgmalrsvggmviesprnetehwlletvgrqaqqagigmptvaiydsadinafatg
    akrddslvavstgllhnmtrdeaeavlahevshiangdmvtmtlmqg
    

    Sequence, based on observed residues (ATOM records):
    >3cqbA (A:)
    naskgmalrsvggmviesprnetehwlletvgrqaqqagigmptvaiydsadinafatga
    kdslvavstgllhnmtrdeaeavlahevshiangdmvtmtlmq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3cqbB (B:)
    snaskgmalrsvggmviesprnetehwlletvgrqaqqagigmptvaiydsadinafatg
    akrddslvavstgllhnmtrdeaeavlahevshiangdmvtmtlmqg
    

    Sequence, based on observed residues (ATOM records):
    >3cqbB (B:)
    malrsvggmviesprnetehwlletvgrqaqqagigmptvaiydsadinafatgakrdds
    lvavstgllhnmtrdeaeavlahevshiangdmvtmtlmqg