PDB entry 3cqa

View 3cqa on RCSB PDB site
Description: Crystal structure of human fibroblast growth factor-1 with mutations Glu81Ala and Lys101Ala
Class: hormone
Keywords: crystal packing, Acetylation, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, HORMONE
Deposited on 2008-04-02, released 2009-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-05, with a file datestamp of 2009-12-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: HOMO SAPIENS
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (84)
      • engineered (104)
    Domains in SCOPe 2.07: d3cqaa_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: HOMO SAPIENS
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (84)
      • engineered (104)
    Domains in SCOPe 2.07: d3cqab_
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cqaA (A:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpnaeclflerleenhyntyiskahaeknwfvglkkngs
    ckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cqaA (A:)
    hhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyik
    stetgqylamdtdgllygsqtpnaeclflerleenhyntyiskahaeknwfvglkkngsc
    krgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cqaB (B:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpnaeclflerleenhyntyiskahaeknwfvglkkngs
    ckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cqaB (B:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpnaeclflerleenhyntyiskahaeknwfvglkkngs
    ckrgprthygqkailflplpv