PDB entry 3cq6

View 3cq6 on RCSB PDB site
Description: Histidinol-phosphate aminotransferase from Corynebacterium glutamicum holo-form (PLP covalently bound )
Class: Transferase
Keywords: histidinol-phosphate aminotransferase, Corynebacterium glutamicum, PLP, Amino-acid biosynthesis, Histidine biosynthesis, Pyridoxal phosphate
Deposited on 2008-04-02, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Corynebacterium glutamicum
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq6a_
  • Chain 'C':
    Compound: Histidinol-phosphate aminotransferase
    Species: Corynebacterium glutamicum
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq6c_
  • Chain 'E':
    Compound: Histidinol-phosphate aminotransferase
    Species: Corynebacterium glutamicum
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq6e_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cq6A (A:)
    gshmtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkia
    telnryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtal
    gfqpsysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdv
    tslddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrl
    gyfvanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarlee
    lgyavvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendaflda
    aaeiiklnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq6A (A:)
    kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr
    yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps
    ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd
    veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva
    npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav
    vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii
    klnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cq6C (C:)
    gshmtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkia
    telnryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtal
    gfqpsysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdv
    tslddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrl
    gyfvanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarlee
    lgyavvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendaflda
    aaeiiklnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq6C (C:)
    kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr
    yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps
    ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd
    veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva
    npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav
    vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii
    klnl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cq6E (E:)
    gshmtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkia
    telnryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtal
    gfqpsysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdv
    tslddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrl
    gyfvanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarlee
    lgyavvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendaflda
    aaeiiklnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq6E (E:)
    kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr
    yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps
    ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd
    veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva
    npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav
    vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii
    klnl