PDB entry 3cq5

View 3cq5 on RCSB PDB site
Description: Histidinol-phosphate aminotransferase from Corynebacterium glutamicum in complex with PMP
Class: Transferase
Keywords: histidinol-phosphate aminotransferase, Corynebacterium glutamicum, PLP, PMP, Amino-acid biosynthesis, Histidine biosynthesis, Pyridoxal phosphate
Deposited on 2008-04-02, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Corynebacterium glutamicum
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq5a_
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase
    Species: Corynebacterium glutamicum
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq5b_
  • Chain 'C':
    Compound: Histidinol-phosphate aminotransferase
    Species: Corynebacterium glutamicum
    Gene: hisC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq5c_
  • Heterogens: SO4, 144, PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cq5A (A:)
    gshmtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkia
    telnryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtal
    gfqpsysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdv
    tslddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrl
    gyfvanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarlee
    lgyavvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendaflda
    aaeiiklnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq5A (A:)
    kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr
    yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps
    ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd
    veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva
    npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav
    vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii
    klnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cq5B (B:)
    gshmtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkia
    telnryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtal
    gfqpsysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdv
    tslddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrl
    gyfvanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarlee
    lgyavvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendaflda
    aaeiiklnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq5B (B:)
    mtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatel
    nryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfq
    psysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsl
    ddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyf
    vanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgy
    avvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaae
    iiklnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cq5C (C:)
    gshmtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkia
    telnryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtal
    gfqpsysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdv
    tslddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrl
    gyfvanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarlee
    lgyavvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendaflda
    aaeiiklnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq5C (C:)
    kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr
    yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps
    ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd
    veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva
    npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav
    vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii
    klnl