PDB entry 3cq4

View 3cq4 on RCSB PDB site
Description: Histidinol-phosphate aminotransferase from Corynebacterium glutamicum
Class: Transferase
Keywords: histidinol-phosphate aminotransferase, Corynebacterium glutamicum, PLP, strep-tag, Amino-acid biosynthesis, Histidine biosynthesis, Pyridoxal phosphate
Deposited on 2008-04-02, released 2008-07-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.239
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Corynebacterium glutamicum
    Gene: hisC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KJU4 (Start-365)
      • expression tag (366-374)
    Domains in SCOPe 2.05: d3cq4a_
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase
    Species: Corynebacterium glutamicum
    Gene: hisC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KJU4 (Start-365)
      • expression tag (366-369)
    Domains in SCOPe 2.05: d3cq4b_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cq4A (A:)
    mtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatel
    nryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfq
    psysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsl
    ddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyf
    vanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgy
    avvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaae
    iiklnlsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq4A (A:)
    kitlsdlplreelrvdirlntnenpyppsealvadlvatvdkiatelrdavelrdelaay
    itkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqpsysmhpilakgthtefi
    avsrgadfridmdvaleeirakqpdivfvttpnnptgdvtslddveriinvapgivivde
    ayaefspspsattllekyptklvvsrtmskafdfaggrlgyfvanpafidavmlvrlpyh
    lsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyavvpsesnfvffgdfsdq
    haawqafldrgvlirdvgiaghlrttigvpeendafldaaaeiiklnlsawshpqfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cq4B (B:)
    mtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatel
    nryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfq
    psysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsl
    ddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyf
    vanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgy
    avvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaae
    iiklnlsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq4B (B:)
    kitlsdlplreelrvdirlntnenpyppsealvadlvatvdkiateldavelrdelaayi
    tkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqpsysmhpilakgthtefia
    vsrgadfridmdvaleeirakqpdivfvttpnnptgdvtslddveriinvapgivivdea
    yaefspspsattllekyptklvvsrtmskafdfaggrlgyfvanpafidavmlvrlpyhl
    salsqaaaivalrhsadtlgtveklsvervrvaarleelgyavvpsesnfvffgdqhaaw
    qafldrgvlirdvgiaghlrttigvpeendafldaaaeiilnlsaws