PDB entry 3cq3

View 3cq3 on RCSB PDB site
Description: Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (other form) from Thermus Thermophilus HB8
Class: oxidoreductase
Keywords: Thermus Thermophilus, DTDP-4-Keto-L-Rhamnose Reductase, OXIDOREDUCTASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2008-04-02, released 2009-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein TTHB138
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq3a_
  • Chain 'B':
    Compound: Putative uncharacterized protein TTHB138
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq3b_
  • Chain 'C':
    Compound: Putative uncharacterized protein TTHB138
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq3c_
  • Chain 'D':
    Compound: Putative uncharacterized protein TTHB138
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq3d_
  • Chain 'E':
    Compound: Putative uncharacterized protein TTHB138
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq3e_
  • Heterogens: MG, GOL, P6G, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cq3A (A:)
    mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdsl
    geavrqalsrlpgveevevevtfeppwtlarlsekarrllgwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq3A (A:)
    npleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeav
    rqalsrlpgveevevevtfeppwtlarlsekarrllgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cq3B (B:)
    mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdsl
    geavrqalsrlpgveevevevtfeppwtlarlsekarrllgwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq3B (B:)
    npleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeav
    rqalsrlpgveevevevtfeppwtlarlsekarrllgw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cq3C (C:)
    mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdsl
    geavrqalsrlpgveevevevtfeppwtlarlsekarrllgwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq3C (C:)
    npleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeav
    rqalsrlpgveevevevtfeppwtlarlsekarrllgw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cq3D (D:)
    mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdsl
    geavrqalsrlpgveevevevtfeppwtlarlsekarrllgwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq3D (D:)
    npleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeav
    rqalsrlpgveevevevtfeppwtlarlsekarrllgw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cq3E (E:)
    mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdsl
    geavrqalsrlpgveevevevtfeppwtlarlsekarrllgwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq3E (E:)
    npleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeav
    rqalsrlpgveevevevtfeppwtlarlsekarrllgw