PDB entry 3cq1

View 3cq1 on RCSB PDB site
Description: Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (TT1362) from Thermus Thermophilus HB8
Class: oxidoreductase
Keywords: Thermus Thermophilus, DTDP-4-Keto-L-Rhamnose Reductase, Plasmid, OXIDOREDUCTASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2008-04-02, released 2009-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein TTHB138
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cq1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cq1A (A:)
    mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdsl
    geavrqalsrlpgveevevevtfeppwtlarlsekarrllgwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cq1A (A:)
    arnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslge
    avrqalsrlpgveevevevtfeppwtlarlsekarrllg