PDB entry 3cpo

View 3cpo on RCSB PDB site
Description: Crystal structure of ketosteroid isomerase D40N with bound 2-fluorophenol
Class: isomerase
Keywords: ENZYME, ACTIVE SITE, BINDING, HYDROGEN BOND, GEOMETRY, Isomerase, Lipid metabolism, Steroid metabolism
Deposited on 2008-03-31, released 2008-09-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.168
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta(5)-3-ketosteroid isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered (39)
    Domains in SCOPe 2.02: d3cpoa_
  • Heterogens: FP2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3cpoA (A:)
mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
sevnlsvrepq

    Sequence, based on observed residues (ATOM records): (download) 
    >3cpoA (A:)
lptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqglk
vracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevnl
sv