PDB entry 3cpl

View 3cpl on RCSB PDB site
Description: Crystal Structure of H-2Db in complex with a variant M6A of the NP366 peptide from influenza A virus
Class: immune system
Keywords: H-2Db, crystal structure, influenza, NP366, immunology, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Polymorphism, Secreted, IMMUNE SYSTEM
Deposited on 2008-03-31, released 2008-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cplb_
  • Chain 'C':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cpld_
  • Chain 'E':
    Compound: NP366 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CPL (0-8)
  • Chain 'F':
    Compound: NP366 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CPL (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cplB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cplD (D:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.