PDB entry 3cpl

View 3cpl on RCSB PDB site
Description: Crystal Structure of H-2Db in complex with a variant M6A of the NP366 peptide from influenza A virus
Class: immune system
Keywords: H-2Db, crystal structure, influenza, NP366, immunology, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Polymorphism, Secreted, IMMUNE SYSTEM
Deposited on 2008-03-31, released 2008-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: H-2 class I histocompatibility antigen, D-B alpha chain
  Species: Mus musculus [TaxId:10090]
  Gene: H2-D1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01899 (0-274)
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.08: d3cplb_
• Chain 'C':
  Compound: H-2 class I histocompatibility antigen, D-B alpha chain
  Species: Mus musculus [TaxId:10090]
  Gene: H2-D1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01899 (0-274)
• Chain 'D':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.08: d3cpld_
• Chain 'E':
  Compound: NP366 peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 3CPL (0-8)
• Chain 'F':
  Compound: NP366 peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 3CPL (0-8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cplB (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cplD (D:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.