PDB entry 3cpj

View 3cpj on RCSB PDB site
Description: Crystal structure of Ypt31 in complex with yeast Rab-GDI
Class: protein transport
Keywords: Rab GTPase, prenylation, vesicular transport, Acetylation, Golgi apparatus, GTP-binding, Lipoprotein, Membrane, Nucleotide-binding, Protein transport, Cytoplasm, GTPase activation, Phosphoprotein
Deposited on 2008-03-31, released 2008-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.202
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: GTP-binding protein YPT31/YPT8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38555
      • engineered (57)
  • Chain 'G':
    Compound: Rab GDP-dissociation inhibitor
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cpjg1, d3cpjg2, d3cpjg3
  • Heterogens: CL, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3cpjG (G:)
    mdqetidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekf
    kqnpiskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfk
    qgkiykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevy
    ykfglgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglg
    elpqgfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpek
    ckstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghy
    laiistiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydassh
    fesmtddvkdiyfrvtghplvlkqrqeqekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cpjG (G:)
    idtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnpi
    skeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgkiy
    kvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfgl
    gnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpqg
    farlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekckstg
    qrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghylaiis
    tiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydasshfesmt
    ddvkdiyfrvtghplvlk