PDB entry 3cph

View 3cph on RCSB PDB site
Description: Crystal structure of Sec4 in complex with Rab-GDI
Class: protein transport
Keywords: Rab GTPase, prenylation, vesicular transport, Cytoplasm, Cytoplasmic vesicle, Exocytosis, GTP-binding, Lipoprotein, Membrane, Nucleotide-binding, Palmitate, Phosphoprotein, Protein transport, GTPase activation
Deposited on 2008-03-31, released 2008-05-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.22
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein SEC4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cpha_
  • Chain 'G':
    Compound: Rab GDP-dissociation inhibitor
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cphg1, d3cphg2, d3cphg3
  • Chain 'H':
    Compound: Rab GDP-dissociation inhibitor
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cphh1, d3cphh2, d3cphh3
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cphA (A:)
    msglrtvsassgngksydsimkilligdsgvgkscllvrfvedkfnpsfittigidfkik
    tvdingkkvklqlwdtagqerfrtittayyrgamgiilvydvtdertftnikqwfktvne
    handeaqlllvgnksdmetrvvtadqgealakelgipfiessaknddnvneifftlakli
    qekidsnklvgvgngkegnisinsgsgnssksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cphA (A:)
    imkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdtagq
    erfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdmet
    rvvtadqgealakelgipfiessaknddnvneifftlakliqekidsnklvgvgn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3cphG (G:)
    mdqetidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekf
    kqnpiskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfk
    qgkiykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevy
    ykfglgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglg
    elpqgfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpek
    ckstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghy
    laiistiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydassh
    fesmtddvkdiyfrvtghplvlkqrqeqekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cphG (G:)
    tidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnp
    iskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgki
    ykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfg
    lgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpq
    gfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekckst
    gqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghylaii
    stiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydasshfesm
    tddvkdiyfrvtghplvlkqr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cphH (H:)
    mdqetidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekf
    kqnpiskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfk
    qgkiykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevy
    ykfglgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglg
    elpqgfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpek
    ckstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghy
    laiistiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydassh
    fesmtddvkdiyfrvtghplvlkqrqeqekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cphH (H:)
    dtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnpis
    keereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgkiyk
    vpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfglg
    nstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpqgf
    arlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekckstgq
    rviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghylaiist
    iietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydasshfesmtd
    dvkdiyfrvtghplvl